-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-414 of human MRPS27 (NP_055899.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MRPS27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-414 of human MRPS27 (NP_055899.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02013A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS27 |
| Target Synonyms | S27mt; MRP-S27; MRPS27 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, A-431, A-549, HT-29, LO2, Mouse liver, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 255-414 of human MRPS27 (NP_055899.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA | Uniprot ID | Q92552 |
Uniprot Id
Q92552
Target Species
Human
Target Name
MRPS27
Target Full Name
Small ribosomal subunit protein mS27
Target Function
RNA-binding component of the mitochondrial small ribosomal subunit (mt-SSU) that plays a role in mitochondrial protein synthesis. Stimulates mitochondrial mRNA translation of subunit components of the mitochondrial electron transport chain. Binds to the mitochondrial 12S rRNA (12S mt-rRNA) and tRNA(Glu). Involved also in positive regulation of cell proliferation and tumor cell growth.
Target Subcellular Location
Cytoplasm. Mitochondrion.
Target Protein Families
Mitochondrion-specific ribosomal protein mS27 family
Target Tissue Specificity
Overexpressed in hepatocellular carcinoma tissues compared with adjacent non-tumoral liver tissues (at protein level). Ubiquitous.
Target Synonyms
28S ribosomal protein S27; 28S ribosomal protein S27, mitochondrial; KIAA0264; Mitochondrial 28S ribosomal protein S27; mitochondrial; mitochondrial ribosomal protein S27; MRP-S27; MRPS27; RT27_HUMAN; S27mt
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that may be a functional partner of the death associated protein 3 (DAP3). Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification