-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOVA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 408-507 of human NOVA1 (NP_002506.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NOVA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 408-507 of human NOVA1 (NP_002506.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02135A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOVA1 |
| Target Synonyms | Nova-1; NOVA1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 408-507 of human NOVA1 (NP_002506.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG | Uniprot ID | P51513 |
Uniprot Id
P51513
Target Species
Human
Target Name
NOVA1
Target Full Name
RNA-binding protein Nova-1
Target Function
Functions to regulate alternative splicing in neurons by binding pre-mRNA in a sequence-specific manner to activate exon inclusion or exclusion. It binds specifically to the sequences 5'-YCAY-3' and regulates splicing in only a subset of regulated exons. Binding to an exonic 5'-YCAY-3' cluster changes the protein complexes assembled on pre-mRNA, blocking U1 snRNP binding and exon inclusion, whereas binding to an intronic 5'-YCAY-3' cluster enhances spliceosome assembly and exon inclusion. Binding to 5'-YCAY-3' clusters results in a local and asymmetric action to regulate spliceosome assembly and alternative splicing in neurons. Binding to an exonic 5'-YCAY-3' cluster changed the protein complexes assembled on pre-mRNA, blocking U1 snRNP (small nuclear ribonucleoprotein) binding and exon inclusion, whereas binding to an intronic 5'-YCAY-3' cluster enhanced spliceosome assembly and exon inclusion. With NOVA1, they perform unique biological functions in different brain areas and cell types. Autoregulates its own expression by acting as a splicing repressor. Acts to activate the inclusion of exon E3A in the glycine receptor alpha-2 chain and of exon E9 in gamma-aminobutyric-acid receptor gamma-2 subunit via a distal downstream UCAU-rich intronic splicing enhancer. Acts to regulate a novel glycine receptor alpha-2 chain splice variant (alpha-2N) in developing spinal cord.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in cerebellum, brain stem, hippocampus, and frontal cortex.
Target Synonyms
Neuro oncological ventral antigen 1; Neuro-oncological ventral antigen 1; NOVA 1; Nova-1; Nova1; NOVA1_HUMAN; Onconeural ventral antigen 1; Paraneoplastic Ri antigen; RNA binding protein Nova 1; RNA-binding protein Nova-1; Ventral neuron specific protein 1; Ventral neuron-specific protein 1
Target Background
This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described.
Notification