Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LCN6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-120 of human LCN6 (NP_945184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LCN6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-120 of human LCN6 (NP_945184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02141A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LCN6 |
| Target Synonyms | LCN5; hLcn5; UNQ643; LCN6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-120 of human LCN6 (NP_945184.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAII | Uniprot ID | P62502 |
Uniprot Id
P62502
Target Species
Human
Target Name
LCN6
Target Full Name
Epididymal-specific lipocalin-6
Target Function
May play a role in male fertility.
Target Subcellular Location
Secreted. Note=Located on the head and tail of spermatozoa with the highest concentration on the post-acrosomal region of the head, where it appears aggregated into large patches.
Target Protein Families
Calycin superfamily, Lipocalin family
Target Tissue Specificity
Predominantly expressed in epididymis.
Target Research Area
Cardiovascular
Target Synonyms
LCN6; LCN5; UNQ643/PRO1273Epididymal-specific lipocalin-6; Lipocalin-5
Target Background
Predicted to enable small molecule binding activity. Predicted to be involved in single fertilization. Predicted to be located in extracellular region.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
