Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SGK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 228-367 of human SGK2 (NP_733794.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SGK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 228-367 of human SGK2 (NP_733794.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02194A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SGK2 |
| Target Synonyms | H-SGK2; dJ138B7.2; SGK2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BxPC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 228-367 of human SGK2 (NP_733794.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC | Uniprot ID | Q9HBY8 |
Uniprot Id
Q9HBY8
Target Species
Human
Target Name
SGK2
Target Full Name
Serine/threonine-protein kinase Sgk2
Target Function
Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, survival and proliferation. Up-regulates Na(+) channels: SCNN1A/ENAC, K(+) channels: KCNA3/Kv1.3, KCNE1 and KCNQ1, amino acid transporter: SLC6A19, glutamate transporter: SLC1A6/EAAT4, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na(+)/H(+) exchanger: SLC9A3/NHE3, and the Na(+)/K(+) ATPase.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family
Target Tissue Specificity
Highly expressed in liver, kidney and pancreas, and at lower levels in brain.
Target Synonyms
SGK2; Serine/threonine-protein kinase Sgk2; EC 2.7.11.1; Serum/glucocorticoid-regulated kinase 2
Target Background
This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
