-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AGTRAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-152 of human AGTRAP (NP_065083.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AGTRAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-152 of human AGTRAP (NP_065083.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02223A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AGTRAP |
| Target Synonyms | ATRAP; AGTRAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, 293T, BxPC-3, HT-29, Mouse testis, Rat kidney, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 93-152 of human AGTRAP (NP_065083.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGR | Uniprot ID | Q6RW13 |
Uniprot Id
Q6RW13
Target Species
Human
Target Name
AGTRAP
Target Full Name
Type-1 angiotensin II receptor-associated protein
Target Function
Appears to be a negative regulator of type-1 angiotensin II receptor-mediated signaling by regulating receptor internalization as well as mechanism of receptor desensitization such as phosphorylation. Induces also a decrease in cell proliferation and angiotensin II-stimulated transcriptional activity.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Present in perinuclear vesicular membranes, Endoplasmic reticulum, Golgi and endocytic vesicles.
Target Tissue Specificity
Ubiquitous but more abundant in kidney, heart, pancreas and thyroid.
Target Synonyms
AGTRAP; ATRAP; Type-1 angiotensin II receptor-associated protein; AT1 receptor-associated protein
Target Background
This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.
Notification