Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human AK1 (NP_000467.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against AK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human AK1 (NP_000467.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02225A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AK1 |
| Target Synonyms | HTL-S-58j; AK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human AK1 (NP_000467.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK | Uniprot ID | P00568 |
Uniprot Id
P00568
Target Species
Human
Target Name
AK1
Target Full Name
Adenylate kinase isoenzyme 1
Target Function
Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Target Involvement
Hemolytic anemia due to adenylate kinase deficiency (HAAKD)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Adenylate kinase family, AK1 subfamily
Target Research Area
Cardiovascular
Target Synonyms
Adenylate kinase 1; Adenylate kinase isoenzyme 1; Adenylate kinase soluble; AK 1; Ak1; ATP AMP transphosphorylase; ATP-AMP transphosphorylase 1; KAD1; KAD1_HUMAN; Myokinase
Target Background
This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. This gene shares readthrough transcripts with the upstream ST6GALNAC6 gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
