Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP6V1E2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-180 of human ATP6V1E2 (NP_542384.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP6V1E2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-180 of human ATP6V1E2 (NP_542384.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02240A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP6V1E2 |
| Target Synonyms | VMA4; ATP6E1; ATP6EL2; ATP6V1EL2; ATP6V1E2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-180 of human ATP6V1E2 (NP_542384.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGG | Uniprot ID | Q96A05 |
Uniprot Id
Q96A05
Target Species
Human
Target Name
ATP6V1E2
Target Full Name
V-type proton ATPase subunit E 2
Target Function
Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
Target Protein Families
V-ATPase E subunit family
Target Tissue Specificity
Testis specific.
Target Synonyms
ATP6V1E2; ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2; V-ATPase subunit E 2; V-type proton ATPase subunit e 2; Vacuolar proton pump subunit e 2; vacuolar type proton-translocating ATPase subunit E1; VATE2_HUMAN
Target Background
Predicted to enable P-type proton-exporting transporter activity. Predicted to act upstream of or within proton transmembrane transport. Predicted to be located in cytosol. Predicted to be part of proton-transporting two-sector ATPase complex, catalytic domain.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
