-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFSF13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 105-247 of human TNFSF13 (NP_742085.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNFSF13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 105-247 of human TNFSF13 (NP_742085.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02334A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFSF13 |
| Target Synonyms | APRIL; CD256; TALL2; ZTNF2; TALL-2; TNLG7B; TRDL-1; UNQ383/PRO715; TNFSF13 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 105-247 of human TNFSF13 (NP_742085.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGL | Uniprot ID | O75888 |
Uniprot Id
O75888
Target Species
Human
Target Name
TNFSF13
Target Full Name
Tumor necrosis factor ligand superfamily member 13
Target Function
Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.
Target Subcellular Location
Secreted.
Target Protein Families
Tumor necrosis factor family
Target Tissue Specificity
Expressed at high levels in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages.
Target Synonyms
A proliferation inducing ligand; A proliferation-inducing ligand; APRIL; CD256; TALL-2; TALL2; TNF related death ligand; TNF- and APOL-related leukocyte expressed ligand 2; TNF-related death ligand 1; TNF13_HUMAN; TNFSF13; TRDL-1; TRDL1; Tumor necrosis factor (ligand) superfamily; member 13; Tumor necrosis factor ligand superfamily member 13; Tumor necrosis factor like protein ZTNF2; Tumor necrosis factor related death ligand 1; UNQ383/PRO715; ZTNF2
Target Background
The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
Notification