Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARHGAP44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 666-772 of human ARHGAP44 (NP_055674.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARHGAP44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 666-772 of human ARHGAP44 (NP_055674.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02557A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARHGAP44 |
| Target Synonyms | RICH2; NPC-A-10; ARHGAP44 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, 293T, MCF7, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 666-772 of human ARHGAP44 (NP_055674.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST | Uniprot ID | Q17R89 |
Uniprot Id
Q17R89
Target Species
Human
Target Name
ARHGAP44
Target Full Name
Rho GTPase-activating protein 44
Target Function
GTPase-activating protein (GAP) that stimulates the GTPase activity of Rho-type GTPases. Thereby, controls Rho-type GTPases cycling between their active GTP-bound and inactive GDP-bound states. Acts as a GAP at least for CDC42 and RAC1. In neurons, is involved in dendritic spine formation and synaptic plasticity in a specific RAC1-GAP activity. Limits the initiation of exploratory dendritic filopodia. Recruited to actin-patches that seed filopodia, binds specifically to plasma membrane sections that are deformed inward by acto-myosin mediated contractile forces. Acts through GAP activity on RAC1 to reduce actin polymerization necessary for filopodia formation. In association with SHANK3, promotes GRIA1 exocytosis from recycling endosomes and spine morphological changes associated to long-term potentiation
Target Subcellular Location
Cell projection, dendritic spine. Recycling endosome. Cell junction, synapse, presynapse. Cell projection, dendrite.
Target Tissue Specificity
Highly expressed in brain. Expressed at weak level in other tissues.
Target Synonyms
ARHGAP44; KIAA0672; RICH2; Rho GTPase-activating protein 44; NPC-A-10; Rho-type GTPase-activating protein RICH2; RhoGAP interacting with CIP4 homologs protein 2; RICH-2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
