-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSNK1G2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 316-415 of human CSNK1G2 (NP_001310.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CSNK1G2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 316-415 of human CSNK1G2 (NP_001310.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02572A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSNK1G2 |
| Target Synonyms | CK1g2; CSNK1G2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HL-60, Mouse brain, Mouse skeletal muscle, Mouse testis, Rat skeletal muscle, SKOV3, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 316-415 of human CSNK1G2 (NP_001310.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK | Uniprot ID | P78368 |
Uniprot Id
P78368
Target Species
Human
Target Name
CSNK1G2
Target Full Name
Casein kinase I isoform gamma-2
Target Function
Serine/threonine-protein kinase. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates COL4A3BP/CERT, MTA1 and SMAD3. Involved in brain development and vesicular trafficking and neurotransmitter releasing from small synaptic vesicles. Regulates fast synaptic transmission mediated by glutamate. SMAD3 phosphorylation promotes its ligand-dependent ubiquitination and subsequent proteasome degradation, thus inhibiting SMAD3-mediated TGF-beta responses. Hyperphosphorylation of the serine-repeat motif of COL4A3BP/CERT leads to its inactivation by dissociation from the Golgi complex, thus down-regulating ER-to-Golgi transport of ceramide and sphingomyelin synthesis. Triggers PER1 proteasomal degradation probably through phosphorylation.
Target Subcellular Location
Cytoplasm, cell cortex. Cytoplasm.
Target Protein Families
Protein kinase superfamily, CK1 Ser/Thr protein kinase family, Casein kinase I subfamily
Target Tissue Specificity
Testis.
Target Synonyms
Casein kinase 1; gamma 2; Casein kinase I isoform gamma 2; Casein kinase I isoform gamma-2; CK1g2; CKI gamma 2; CKI-gamma 2; CSNK1G 2; Csnk1g2; KC1G2_HUMAN
Target Background
Enables protein serine/threonine kinase activity. Involved in peptidyl-serine phosphorylation. Located in membrane.
Notification