-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 256-446 of human ADA2 (NP_001269154.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 256-446 of human ADA2 (NP_001269154.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02719A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADA2 |
| Target Synonyms | PAN; ADGF; CECR1; IDGFL; SNEDS; VAIHS; ADA2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat plasma | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 256-446 of human ADA2 (NP_001269154.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMF | Uniprot ID | Q9NZK5 |
Uniprot Id
Q9NZK5
Target Species
Human
Target Name
ADA2
Target Full Name
Adenosine deaminase 2
Target Function
Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity.
Target Involvement
Polyarteritis nodosa (PAN); Sneddon syndrome (SNDDS)
Target Subcellular Location
Secreted.
Target Protein Families
Metallo-dependent hydrolases superfamily, Adenosine and AMP deaminases family, ADGF subfamily
Target Tissue Specificity
Detected in blood plasma (at protein level). Widely expressed, with most abundant expression in human adult heart, lung, lymphoblasts, and placenta as well as fetal lung, liver, and kidney. In embryo, expressed in the outflow tract and atrium of the devel
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ADA2; ADGF; CECR1; IDGFLAdenosine deaminase 2; EC 3.5.4.4; Cat eye syndrome critical region protein 1
Target Background
This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants.
Notification