Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HIRIP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 417-556 of human HIRIP3 (NP_003600.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HIRIP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 417-556 of human HIRIP3 (NP_003600.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02742A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HIRIP3 |
| Target Synonyms | HIRIP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HL-60, Jurkat, Mouse liver, Mouse skeletal muscle, Rat skeletal muscle, U-937 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 417-556 of human HIRIP3 (NP_003600.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRRGEDHPAVMRLKRYIRACGAHRNYKKLLGSCCSHKERLSILRAELEALGMKGTPSLGKCRALKEQREEAAEVASLDVANIISGSGRPRRRTAWNPLGEAAPPGELYRRTLDSDEERPRPAPPDWSHMRGIISSDGESN | Uniprot ID | Q9BW71 |
Uniprot Id
Q9BW71
Target Species
Human
Target Name
HIRIP3
Target Full Name
HIRA-interacting protein 3
Target Function
May play a role in chromatin function and histone metabolism via its interaction with HIRA and histones.
Target Subcellular Location
Nucleus. Note=Nuclear throughout the cell cycle and is excluded from condensed chromatin during mitosis.
Target Tissue Specificity
Widely expressed. Isoform 1 is predominant in skeletal muscle. Isoform 2 is predominant in liver and heart.
Target Synonyms
HIRA-interacting protein 3; HIRIP3; HIRP3; HIRP3_HUMAN
Target Background
The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of a multiprotein complex. Several cDNAs encoding HIRA-interacting proteins, or HIRIPs, have been identified. In vitro, the protein encoded by this gene binds HIRA, as well as H2B and H3 core histones, indicating that a complex containing HIRA-HIRIP3 could function in some aspects of chromatin and histone metabolism. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
