-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human SSBP1 (NP_001243442.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against SSBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human SSBP1 (NP_001243442.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-02758A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSBP1 |
| Target Synonyms | SSBP; OPA13; mtSSB; Mt-SSB; SOSS-B1; SSBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HL-60, Mouse liver, SW620 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human SSBP1 (NP_001243442.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE | Uniprot ID | Q04837 |
Uniprot Id
Q04837
Target Species
Human
Target Name
SSBP1
Target Full Name
Single-stranded DNA-binding protein, mitochondrial
Target Function
Binds preferentially and cooperatively to pyrimidine rich single-stranded DNA (ss-DNA). In vitro, required to maintain the copy number of mitochondrial DNA (mtDNA) and plays a crucial role during mtDNA replication by stimulating the activity of the replisome components POLG and TWNK at the replication fork. Promotes the activity of the gamma complex polymerase POLG, largely by organizing the template DNA and eliminating secondary structures to favor ss-DNA conformations that facilitate POLG activity. In addition it is able to promote the 5'-3' unwinding activity of the mtDNA helicase TWNK. May also function in mtDNA repair.
Target Subcellular Location
Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid.
Target Tissue Specificity
Expressed in retinal ganglion cells, photoreceptors, pigmented epithelium and fibroblasts (at protein level).
Target Synonyms
mitochondrial; Mt SSB; Mt-SSB; MtSSB; PWP1 interacting protein 17; PWP1-interacting protein 17; SENSOR OF SINGLE-STRANDED DNA COMPLEX; Single stranded DNA binding protein 1; Single stranded DNA binding protein; Single stranded DNA binding protein mitochondrial; Single-stranded DNA-binding protein; SOSS B1; SOSS COMPLEX, SUBUNIT B1; SSBP 1; SSBP; SSBP_HUMAN; SSBP1
Target Background
SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501].
Notification