-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Histone H1.0 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human H1F0 (NP_005309.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Histone H1.0 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human H1F0 (NP_005309.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02792A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Histone H1.0 |
| Target Synonyms | H10; H1.0; H1F0; H1FV; Histone H1.0 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2, Jurkat, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human H1F0 (NP_005309.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK | Uniprot ID | P07305 |
Uniprot Id
P07305
Target Species
Human
Target Name
H1-0
Target Full Name
Histone H1.0
Target Function
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The histones H1.0 are found in cells that are in terminal stages of differentiation or that have low rates of cell division.
Target Subcellular Location
Nucleus. Chromosome. Note=The RNA edited version has been localized to nuclear speckles. During mitosis, it appears in the vicinity of condensed chromosomes.
Target Protein Families
Histone H1/H5 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
H1 histone family member 0; H1(0); H10; H10_HUMAN; h1f0; H1FV; Histone H1''; Histone H1(0); Histone H1.0; Histone H10; Histone H5; MGC5241; N-terminally processed
Target Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-independent histone that is a member of the histone H1 family.
Notification