Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERCC8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human ERCC8 (NP_000073.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ERCC8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human ERCC8 (NP_000073.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02810A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERCC8 |
| Target Synonyms | CSA; CKN1; UVSS2; ERCC8 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human ERCC8 (NP_000073.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SCGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG | Uniprot ID | Q13216 |
Uniprot Id
Q13216
Target Species
Human
Target Name
ERCC8
Target Full Name
DNA excision repair protein ERCC-8
Target Function
Substrate-recognition component of the CSA complex, a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex, involved in transcription-coupled nucleotide excision repair. The CSA complex (DCX(ERCC8) complex) promotes the ubiquitination and subsequent proteasomal degradation of ERCC6 in a UV-dependent manner; ERCC6 degradation is essential for the recovery of RNA synthesis after transcription-coupled repair. It is required for the recruitment of XAB2, HMGN1 and TCEA1/TFIIS to a transcription-coupled repair complex which removes RNA polymerase II-blocking lesions from the transcribed strand of active genes. Plays a role in DNA single-strand and double-strand breaks (DSSBs) repair; involved in repair of DSSBs by non-homologous end joining (NHEJ)
Target Involvement
Cockayne syndrome A (CSA); UV-sensitive syndrome 2 (UVSS2)
Target Subcellular Location
Nucleus. Nucleus matrix.
Target Synonyms
CKN1; Cockayne syndrome type A; Cockayne syndrome WD repeat protein CSA; CSA; DNA excision repair protein ERCC-8; DNA excision repair protein ERCC8; ERCC 8; ERCC8; ERCC8_HUMAN; excision repair cross-complementing rodent repair deficiency, complementation group 8
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
