Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL9R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL9R (XP_011529456.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL9R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL9R (XP_011529456.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02921A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL9R |
| Target Synonyms | CD129; IL-9R; IL9R | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL9R (XP_011529456.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPA | Uniprot ID | Q01113 |
Uniprot Id
Q01113
Target Species
Human
Target Name
IL9R
Target Full Name
Interleukin-9 receptor
Target Function
This is a receptor for interleukin-9.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted.
Target Protein Families
Type I cytokine receptor family, Type 4 subfamily
Target Synonyms
CD129; IL-9R; IL9R
Target Background
The protein encoded by this gene is a cytokine receptor that specifically mediates the biological effects of interleukin 9 (IL9). The functional IL9 receptor complex requires this protein as well as the interleukin 2 receptor, gamma (IL2RG), a common gamma subunit shared by the receptors of many different cytokines. The ligand binding of this receptor leads to the activation of various JAK kinases and STAT proteins, which connect to different biologic responses. This gene is located at the pseudoautosomal regions of X and Y chromosomes. Genetic studies suggested an association of this gene with the development of asthma. Multiple pseudogenes on chromosome 9, 10, 16, and 18 have been described. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
