-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASF1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B (NP_060624.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ASF1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B (NP_060624.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02988A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASF1B |
| Target Synonyms | CIA-II; ASF1B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B (NP_060624.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI | Uniprot ID | Q9NVP2 |
Uniprot Id
Q9NVP2
Target Species
Human
Target Name
ASF1B
Target Full Name
Histone chaperone ASF1B
Target Function
Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA. Required for spermatogenesis.
Target Subcellular Location
Nucleus.
Target Protein Families
ASF1 family
Target Tissue Specificity
Highly expressed in testis and at lower levels in colon, small intestine and thymus.
Target Synonyms
Anti silencing function 1B; Anti silencing function 1B histone chaperone; Anti-silencing function protein 1 homolog B; ASF1 anti silencing function 1 homolog B (S. cerevisiae); ASF1 anti silencing function 1 homolog B; ASF1B; ASF1B_HUMAN; CCG1 interacting factor A II; CCG1-interacting factor A-II; CIA-II; hAsf1; hAsf1b; hCIA-II; Histone chaperone ASF1B
Target Background
This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
Notification