-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNOT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-540 of human CNOT2 (NP_055330.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CNOT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-540 of human CNOT2 (NP_055330.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03269A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNOT2 |
| Target Synonyms | NOT2; CDC36; NOT2H; HSPC131; IDNADFS; CNOT2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HT-29, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 341-540 of human CNOT2 (NP_055330.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF | Uniprot ID | Q9NZN8 |
Uniprot Id
Q9NZN8
Target Species
Human
Target Name
CNOT2
Target Full Name
CCR4-NOT transcription complex subunit 2
Target Function
Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. Required for the CCR4-NOT complex structural integrity. Can repress transcription and may link the CCR4-NOT complex to transcriptional regulation; the repressive function may specifically involve the N-Cor repressor complex containing HDAC3, NCOR1 and NCOR2. Involved in the maintenance of embryonic stem (ES) cell identity.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
CNOT2/3/5 family
Target Tissue Specificity
Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes.
Target Synonyms
CCR4 associated factor 2; CCR4 NOT transcription complex subunit 2; CCR4-associated factor 2; CCR4-NOT transcription complex subunit 2; CDC36; CNOT2; CNOT2_HUMAN; HSPC131; MSTP046; Negative regulator of transcription 2; NOT2 (negative regulator of transcription 2 yeast) homolog; NOT2; NOT2H
Target Background
This gene encodes a subunit of the multi-component CCR4-NOT complex. The CCR4-NOT complex regulates mRNA synthesis and degradation and is also thought to be involved in mRNA splicing, transport and localization. The encoded protein interacts with histone deacetylases and functions as a repressor of polymerase II transcription. Alternatively spliced transcript variants have been observed for this gene.
Notification