-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MBNL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-260 of human MBNL2 (NP_659002.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MBNL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-260 of human MBNL2 (NP_659002.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03274A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MBNL2 |
| Target Synonyms | MBLL; MBLL39; PRO2032; MBNL2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-260 of human MBNL2 (NP_659002.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQA | Uniprot ID | Q5VZF2 |
Uniprot Id
Q5VZF2
Target Species
Human
Target Name
MBNL2
Target Full Name
Muscleblind-like protein 2
Target Function
Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. RNA-binding protein that binds to 5'ACACCC-3' core sequence, termed zipcode, within the 3'UTR of ITGA3. Binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. Seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm at adhesion plaques. May play a role in myotonic dystrophy pathophysiology (DM)
Target Subcellular Location
Nucleus. Cytoplasm. Note=Greater concentration in the nucleus. Expressed in or near large cytoplasmic adhesion plaques (PubMed:16273094). Location in the cytoplasm is microtubule-dependent (PubMed:16273094). In both DM1 and DM2 patients, colocalizes with nuclear foci of retained expanded-repeat transcripts (PubMed:11929853).
Target Protein Families
Muscleblind family
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
DKFZp781H1296; MBLL; MBLL39; Mbnl2; MBNL2_HUMAN; MGC120625; MGC120626; MGC120628; Muscleblind like 2; muscleblind like protein 1; muscleblind like protein 2; muscleblind like protein like 39; muscleblind like splicing regulator 2; Muscleblind-like protein 1; Muscleblind-like protein 2; Muscleblind-like protein-like 39; Muscleblind-like protein-like; OTTHUMP00000178763; PRO2032; RP11-128N14.1
Notification