Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYT13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-180 of human SYT13 (NP_065877.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SYT13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-180 of human SYT13 (NP_065877.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03285A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYT13 |
| Target Synonyms | SYT13 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-180 of human SYT13 (NP_065877.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRL | Uniprot ID | Q7L8C5 |
Uniprot Id
Q7L8C5
Target Species
Human
Target Name
SYT13
Target Full Name
Synaptotagmin-13
Target Function
May be involved in transport vesicle docking to the plasma membrane.
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Protein Families
Synaptotagmin family
Target Tissue Specificity
Expressed in brain, pancreas and kidney.
Target Synonyms
Synaptotagmin XIII; Synaptotagmin-13; Syt13; SYT13_HUMAN; SytXIII
Target Background
This gene encodes a member of the large synaptotagmin protein family. Family members have an extracellular N-terminal transmembrane domain and a cytoplasmic C terminus with two tandem C2 domains (C2A and C2B). Synaptotogmin family members can form homo- and heteromeric complexes with each other. They also have different biochemical properties and developmental profiles, and patterns of tissue distribution. Synaptotagmins function as membrane traffickers in multicellular organisms. Two alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
