Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSNK1G3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 304-423 of human CSNK1G3 (NP_001026982.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CSNK1G3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 304-423 of human CSNK1G3 (NP_001026982.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03374A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSNK1G3 |
| Target Synonyms | CSNK1G3L; CKI-gamma 3; CSNK1G3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse brain, Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 304-423 of human CSNK1G3 (NP_001026982.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQRHK | Uniprot ID | Q9Y6M4 |
Uniprot Id
Q9Y6M4
Target Species
Human
Target Name
CSNK1G3
Target Full Name
Casein kinase I isoform gamma-3
Target Function
Serine/threonine-protein kinase. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Regulates fast synaptic transmission mediated by glutamate.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, CK1 Ser/Thr protein kinase family, Casein kinase I subfamily
Target Synonyms
CSNK1G3; Casein kinase I isoform gamma-3; CKI-gamma 3; EC 2.7.11.1
Target Background
This gene encodes a member of a family of serine/threonine protein kinases that phosphorylate caseins and other acidic proteins. A related protein in the African clawed frog participates in the transmission of Wnt/beta-catenin signaling. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
