Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against INSL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-139 of human INSL4 (NP_002186.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against INSL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-139 of human INSL4 (NP_002186.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03379A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | INSL4 |
| Target Synonyms | EPIL; PLACENTIN; INSL4 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-139 of human INSL4 (NP_002186.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT | Uniprot ID | Q14641 |
Uniprot Id
Q14641
Target Species
Human
Target Name
INSL4
Target Full Name
Early placenta insulin-like peptide
Target Function
May play an important role in trophoblast development and in the regulation of bone formation.
Target Subcellular Location
Secreted.
Target Protein Families
Insulin family
Target Tissue Specificity
Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells.
Target Synonyms
early placenta insulin like peptide (EPIL) ; Early placenta insulin like peptide A chain; Early placenta insulin like peptide; Early placenta insulin like peptide B chain; Early placenta insulin-like peptide A chain; EPIL; INSL4; INSL4_HUMAN; insulin like 4 ; insulin like 4 (placenta); Insulin like peptide 4; Insulin-like peptide 4; OTTHUMP00000021025; Placentin
Target Background
INSL4 encodes the insulin-like 4 protein, a member of the insulin superfamily. INSL4 encodes a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. Expression of INSL4 products occurs within the early placental cytotrophoblast and syncytiotrophoblast.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
