-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PITPNM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human PITPNM1 (NP_004901.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PITPNM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human PITPNM1 (NP_004901.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03405A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PITPNM1 |
| Target Synonyms | Rd9; NIR2; RDGB; DRES9; RDGB1; RDGBA; PITPNM; RDGBA1; PITPNM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, LO2, Mouse brain, Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human PITPNM1 (NP_004901.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTAAQTGPLMCAY | Uniprot ID | O00562 |
Uniprot Id
O00562
Target Species
Human
Target Name
PITPNM1
Target Full Name
Membrane-associated phosphatidylinositol transfer protein 1
Target Function
Catalyzes the transfer of phosphatidylinositol (PI) between membranes. Binds PI, phosphatidylcholine (PC) and phosphatidic acid (PA) with the binding affinity order of PI > PA > PC. Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.
Target Subcellular Location
Cytoplasm. Golgi apparatus, Golgi stack membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein. Lipid droplet. Cleavage furrow. Midbody.
Target Protein Families
PtdIns transfer protein family, PI transfer class IIA subfamily
Target Tissue Specificity
Ubiquitous.
Target Research Area
Transport
Target Synonyms
DRES9; Drosophila retinal degeneration B; Drosophila retinal degeneration B homolog; FLJ44997; membrane-associated 1; Membrane-associated phosphatidylinositol transfer protein 1; NIR 2; NIR-2; NIR2; OTTHUMP00000236414; OTTHUMP00000236415; Phosphatidylinositol transfer protein; phosphatidylinositol transfer protein membrane associated; PITM1_HUMAN; PITPnm 1; PITPNM; Pitpnm1; PYK2 N terminal domain interacting receptor 2 ; Pyk2 N-terminal domain-interacting receptor 2; RD 9; RD9; RDGB; RDGB1; RDGBA1; retinal degeneration B alpha 1
Target Background
PITPNM1 belongs to a family of membrane-associated phosphatidylinositol transfer domain-containing proteins that share homology with the Drosophila retinal degeneration B (rdgB) protein (Ocaka et al., 2005 [PubMed 15627748]).
Notification