-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNAJB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human DNAJB4 (NP_008965.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNAJB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human DNAJB4 (NP_008965.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03413A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNAJB4 |
| Target Synonyms | DjB4; HLJ1; DNAJW; DNAJB4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human DNAJB4 (NP_008965.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPV | Uniprot ID | Q9UDY4 |
Uniprot Id
Q9UDY4
Target Species
Human
Target Name
DNAJB4
Target Full Name
DnaJ homolog subfamily B member 4
Target Function
Probable chaperone. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro).
Target Subcellular Location
Cytoplasm. Cell membrane. Note=Cytoplasmic according to PubMed:18837411 and membrane-associated according to PubMed:16542645.
Target Tissue Specificity
Expressed in heart, pancreas and skeletal muscle, and to a lesser extent in brain, placenta and liver.
Target Synonyms
DjB4; DnaJ (Hsp40) homolog subfamily B member 4; DnaJ homolog subfamily B member 4; DnaJ like heat shock protein 40; DNAJB 4; DNAJB4; DNAJW; DNJB4_HUMAN; Heat shock 40 kDa protein 1 homolog; Heat shock protein 40 homolog; HLJ 1; HLJ1; HSP40 homolog; Human liver DnaJ-like protein
Target Background
The protein encoded by this gene is a molecular chaperone, tumor suppressor, and member of the heat shock protein-40 family. The encoded protein binds the cell adhesion protein E-cadherin and targets it to the plasma membrane. This protein also binds incorrectly folded E-cadherin and targets it for endoplasmic reticulum-associated degradation. This gene is a strong tumor suppressor for colorectal carcinoma, and downregulation of it may serve as a good biomarker for predicting patient outcomes. Several transcript variants encoding different isoforms have been found for this gene.
Notification