-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against A1CF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human A1CF (NP_055391.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against A1CF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human A1CF (NP_055391.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03420A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | A1CF |
| Target Synonyms | ACF; ASP; ACF64; ACF65; APOBEC1CF; A1CF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human A1CF (NP_055391.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE | Uniprot ID | Q9NQ94 |
Uniprot Id
Q9NQ94
Target Species
Human
Target Name
A1CF
Target Full Name
APOBEC1 complementation factor
Target Function
Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay.
Target Subcellular Location
Nucleus. Endoplasmic reticulum. Cytoplasm.
Target Tissue Specificity
Widely expressed with highest levels in brain, liver, pancreas, colon and spleen.
Target Synonyms
A1CF; A1CF_HUMAN; ACF ; ACF64 ; ACF65 ; Apo B RNA editing protein ; Apobec 1 complementation factor ; Apobec 1 complementation factor (ACF) (ASP); APOBEC 1 stimulating protein ; APOBEC1 complementation factor; APOBEC1 stimulating protein; APOBEC1-stimulating protein; APOBEC1CF ; ASP ; MGC163391; RP11-564C4.2
Target Background
Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Several transcript variants encoding a few different isoforms have been found for this gene.
Notification