-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RanGAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 398-587 of human RanGAP1 (NP_002874.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RanGAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 398-587 of human RanGAP1 (NP_002874.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03594A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RANGAP1 |
| Target Synonyms | SD; Fug1; RANGAP; RanGAP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, BT-474, Jurkat, MCF7, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 398-587 of human RanGAP1 (NP_002874.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV | Uniprot ID | P46060 |
Uniprot Id
P46060
Target Species
Human
Target Name
RANGAP1
Target Full Name
Ran GTPase-activating protein 1
Target Function
GTPase activator for RAN. Converts cytoplasmic GTP-bound RAN to GDP-bound RAN, which is essential for RAN-mediated nuclear import and export. Mediates dissociation of cargo from nuclear export complexes containing XPO1, RAN and RANBP2 after nuclear export.
Target Subcellular Location
Cytoplasm. Nucleus, nucleoplasm. Nucleus envelope. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
RNA1 family
Target Tissue Specificity
Highly expressed in brain, thymus and testis.
Target Synonyms
Fug 1; Fug1; GTPase-activating protein, RAN, 1; KIAA1835; MGC20266; OTTHUMP00000028918; OTTHUMP00000198755; OTTHUMP00000198756; OTTHUMP00000198757; OTTHUMP00000198758; RAGP1_HUMAN; Ran 1; RAN GTPase activating protein 1; Ran GTPase-activating protein 1; Ran1; RANGAP 1; RANGAP; RanGAP1; SD; Segregation distorter homolog; Segregation distortion
Target Background
This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants.
Notification