-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SH2B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-520 of human SH2B1 (NP_056318.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against SH2B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-520 of human SH2B1 (NP_056318.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03744A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SH2B1 |
| Target Synonyms | PSM; SH2B; SH2B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-520 of human SH2B1 (NP_056318.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPTGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQ | Uniprot ID | Q9NRF2 |
Uniprot Id
Q9NRF2
Target Species
Human
Target Name
SH2B1
Target Full Name
SH2B adapter protein 1
Target Function
Adapter protein for several members of the tyrosine kinase receptor family. Involved in multiple signaling pathways mediated by Janus kinase (JAK) and receptor tyrosine kinases, including the receptors of insulin (INS), insulin-like growth factor I (IGF1), nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), glial cell line-derived neurotrophic factor (GDNF), platelet-derived growth factor (PDGF) and fibroblast growth factors (FGFs). In growth hormone (GH) signaling, autophosphorylated ('Tyr-813') JAK2 recruits SH2B1, which in turn is phosphorylated by JAK2 on tyrosine residues. These phosphotyrosines form potential binding sites for other signaling proteins. GH also promotes serine/threonine phosphorylation of SH2B1 and these phosphorylated residues may serve to recruit other proteins to the GHR-JAK2-SH2B1 complexes, such as RAC1. In leptin (LEP) signaling, binds to and potentiates the activation of JAK2 by globally enhancing downstream pathways. In response to leptin, binds simultaneously to both, JAK2 and IRS1 or IRS2, thus mediating formation of a complex of JAK2, SH2B1 and IRS1 or IRS2. Mediates tyrosine phosphorylation of IRS1 and IRS2, resulting in activation of the PI 3-kinase pathway. Acts as positive regulator of NGF-mediated activation of the Akt/Forkhead pathway; prolongs NGF-induced phosphorylation of AKT1 on 'Ser-473' and AKT1 enzymatic activity. Enhances the kinase activity of the cytokine receptor-associated tyrosine kinase JAK2 and of other receptor tyrosine kinases, such as FGFR3 and NTRK1. For JAK2, the mechanism seems to involve dimerization of both, SH2B1 and JAK2. Enhances RET phosphorylation and kinase activity. Isoforms seem to be differentially involved in IGF-I and PDGF-induced mitogenesis.
Target Subcellular Location
Cytoplasm. Membrane. Nucleus.
Target Protein Families
SH2B adapter family
Target Tissue Specificity
Widely expressed with highest levels in skeletal muscle and ovary.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DKFZp547G1110; FLJ30542; KIAA1299; PH and SH2 domain-containing signaling mediator; Pro-rich; Pro-rich, PH and SH2 domain-containing signaling mediator; PSM; SH2 B; SH2 domain-containing protein 1B; SH2 domain-containing putative adapter SH2-B; SH2-B signaling protein; SH2B; SH2B adapter protein 1; SH2B adaptor protein 1; Sh2b1; SH2B1 protein; SH2B1_HUMAN
Target Background
This gene encodes a member of the SH2-domain containing mediators family. The encoded protein mediates activation of various kinases and may function in cytokine and growth factor receptor signaling and cellular transformation. Alternatively spliced transcript variants have been described.
Notification