-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCNN1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 105-225 of human SCNN1A (NP_001029.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SCNN1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 105-225 of human SCNN1A (NP_001029.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03753A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCNN1A |
| Target Synonyms | BESC2; ENaCa; SCNEA; SCNN1; LIDLS3; PHA1B1; ENaCalpha; SCNN1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 105-225 of human SCNN1A (NP_001029.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIG | Uniprot ID | P37088 |
Uniprot Id
P37088
Target Species
Human
Target Name
SCNN1A
Target Full Name
Epithelial sodium channel subunit alpha
Target Function
Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and eccrine sweat glands. Also plays a role in taste perception.
Target Involvement
Pseudohypoaldosteronism 1, autosomal recessive (PHA1B); Bronchiectasis with or without elevated sweat chloride 2 (BESC2)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell projection, cilium. Cytoplasmic granule. Cytoplasm. Cytoplasmic vesicle, secretory vesicle, acrosome. Cell projection, cilium, flagellum.
Target Protein Families
Amiloride-sensitive sodium channel (TC 1.A.6) family, SCNN1A subfamily
Target Tissue Specificity
Expressed in the female reproductive tract, from the fimbrial end of the fallopian tube to the endometrium (at protein level). Expressed in kidney (at protein level). In the respiratory tract, expressed in the bronchial epithelium (at protein level). High
Target Synonyms
Alpha ENaC 2; Alpha ENaC; Alpha NaCH; Alpha-ENaC; Alpha-NaCH; Amiloride sensitive epithelial sodium channel alpha subunit; Amiloride sensitive sodium channel subunit alpha; Amiloride-sensitive sodium channel subunit alpha; ENaCA; ENaCalpha; Epithelial Na(+) channel subunit alpha; Epithelial Na+ channel subunit alpha; FLJ21883; Nonvoltage gated sodium channel 1 subunit alpha; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA; SCNN 1; SCNN1; Scnn1a; SCNNA_HUMAN; Sodium channel nonvoltage gated 1 alpha
Target Background
Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the alpha subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification