Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYL7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human MYL7 (NP_067046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYL7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human MYL7 (NP_067046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03883A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYL7 |
| Target Synonyms | MYL2A; MYLC2A; MYL7 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human MYL7 (NP_067046.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE | Uniprot ID | Q01449 |
Uniprot Id
Q01449
Target Species
Human
Target Name
MYL7
Target Full Name
Myosin regulatory light chain 2, atrial isoform
Target Research Area
Signal Transduction
Target Synonyms
zgc:92755; atrial isoform; cmlc2; MGC92755; MLC-2a; MLC2a; MLCK; cardiac; MLRA_HUMAN; MYL2A; MYL7; Mylc2a; Myosin light chain 2a; Myosin light chain 7 regulatory; Myosin light polypeptide 7 regulatory; Myosin regulatory light chain 2; Myosin regulatory light chain 2 atrial isoform; Myosin regulatory light chain 7
Target Background
Predicted to enable calcium ion binding activity. Located in A band.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
