Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIGLEC9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-340 of human SIGLEC9 (NP_001185487.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIGLEC9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-340 of human SIGLEC9 (NP_001185487.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03914A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIGLEC9 |
| Target Synonyms | CD329; CDw329; FOAP-9; siglec-9; OBBP-LIKE; SIGLEC9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, K-562, Mouse brain, Raji, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-340 of human SIGLEC9 (NP_001185487.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSK | Uniprot ID | Q9Y336 |
Uniprot Id
Q9Y336
Target Species
Human
Target Name
SIGLEC9
Target Full Name
Sialic acid-binding Ig-like lectin 9
Target Function
Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family
Target Tissue Specificity
Expressed by peripheral blood leukocytes (neutrophils and monocytes but not eosinophils). Found in liver, fetal liver, bone marrow, placenta, spleen and in lower levels in skeletal muscle, fetal brain, stomach, lung, thymus, prostate, brain, mammary, adre
Target Synonyms
CD329; CDw329; FOAP-9; siglec-9; OBBP-LIKE; SIGLEC9
Target Background
Predicted to enable monosaccharide binding activity and sialic acid binding activity. Predicted to be involved in cell adhesion. Predicted to act upstream of or within negative regulation of inflammatory response and negative regulation of phagocytosis, engulfment. Predicted to be located in external side of plasma membrane. Predicted to be active in plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
