Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GOSR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GOSR2 (NP_004278.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GOSR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GOSR2 (NP_004278.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03972A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GOSR2 |
| Target Synonyms | Bos1; EPM6; GS27; MYOS; GOSR2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, HT-1080, HT-29, K-562, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GOSR2 (NP_004278.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK | Uniprot ID | O14653 |
Uniprot Id
O14653
Target Species
Human
Target Name
GOSR2
Target Full Name
Golgi SNAP receptor complex member 2
Target Function
Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.
Target Involvement
Epilepsy, progressive myoclonic 6 (EPM6)
Target Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Single-pass type IV membrane protein. Golgi apparatus membrane. Endoplasmic reticulum membrane.
Target Protein Families
GOSR2 family
Target Research Area
Signal Transduction
Target Synonyms
2310032N09Rik; 27 kDa Golgi SNARE protein; Bos1; EPM6; Golgi SNAP receptor complex member 2; Golgi SNARE ; Gosr2; GOSR2_HUMAN; Gs27; Membrin; SNARE
Target Background
This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
