Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF1AY was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human EIF1AY (NP_004672.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EIF1AY was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human EIF1AY (NP_004672.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03981A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF1AY |
| Target Synonyms | eIF-4C; EIF1AY | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat brain, Jurkat, MCF7, Mouse brain, Raji, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human EIF1AY (NP_004672.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI | Uniprot ID | O14602 |
Uniprot Id
O14602
Target Species
Human
Target Name
EIF1AY
Target Full Name
Eukaryotic translation initiation factor 1A, Y-chromosomal
Target Function
Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.
Target Protein Families
EIF-1A family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
eIF 1A Y isoform; eIF 4C; eIF-1A Y isoform; EIF-4C; EIF1AY; Eukaryotic translation initiation factor 1A; Eukaryotic translation initiation factor 1A; Y chromosomal; Eukaryotic translation initiation factor 1A; Y linked; Eukaryotic translation initiation factor 4C; IF1AY_HUMAN; Y-chromosomal
Target Background
This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
