-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBL4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against UBL4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-03993A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBL4A |
| Target Synonyms | GDX; G6PD; GET5; MDY2; UBL4; TMA24; DX254E; DXS254E; UBL4A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, Mouse brain, U-87MG | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK | Uniprot ID | P11441 |
Uniprot Id
P11441
Target Species
Human
Target Name
UBL4A
Target Full Name
Ubiquitin-like protein 4A
Target Function
As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates in their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum. Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome. Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Synonyms
DX254E; DXS254E; G6PD; GDX; OTTHUMP00000061462; Ubiquitin like 4; Ubiquitin like 4A; Ubiquitin like protein 4A; Ubiquitin like protein GDX; Ubiquitin-like protein 4A; Ubiquitin-like protein GDX; UBL 4; UBL 4A; UBL4; Ubl4a; UBL4A_HUMAN
Target Background
Enables chaperone binding activity. Involved in tail-anchored membrane protein insertion into ER membrane. Located in cytosol; membrane; and nucleoplasm. Part of BAT3 complex.
Notification