Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CETN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CETN1 (NP_004057.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CETN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CETN1 (NP_004057.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04068A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CETN1 |
| Target Synonyms | CEN1; CETN; CETN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, MCF7, Mouse testis, Rat testis, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CETN1 (NP_004057.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY | Uniprot ID | Q12798 |
Uniprot Id
Q12798
Target Species
Human
Target Name
CETN1
Target Full Name
Centrin-1
Target Function
Plays a fundamental role in microtubule-organizing center structure and function. Plays a role in sperm cilia formation.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell projection, cilium.
Target Protein Families
Centrin family
Target Research Area
Signal Transduction
Target Synonyms
Caltractin; Caltractin isoform 2; CEN 1; CEN1; Centrin EF hand protein 1; Centrin-1; Centrin1; CETN 1; CETN; CETN1; CETN1_HUMAN; EF hand protein 1
Target Background
The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
