Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPY2R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human NPY2R (NP_000901.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NPY2R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human NPY2R (NP_000901.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04122A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPY2R |
| Target Synonyms | NPY2-R; NPY2R | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human NPY2R (NP_000901.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV | Uniprot ID | P49146 |
Uniprot Id
P49146
Target Species
Human
Target Name
NPY2R
Target Full Name
Neuropeptide Y receptor type 2
Target Function
Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY > NPY > PYY (3-36) > NPY (2-36) > [Ile-31, Gln-34] PP > [Leu-31, Pro-34] NPY > PP, [Pro-34] PYY and NPY free acid.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
High levels in amygdala, corpus callosum, hippocampus and subthalamic nucleus. Also detectable in caudate nucleus, hypothalamus and substantia nigra.
Target Research Area
Cardiovascular
Target Synonyms
NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor
Target Background
Predicted to enable calcium channel regulator activity and neuropeptide Y receptor activity. Involved in cardiac left ventricle morphogenesis and outflow tract morphogenesis. Located in cilium. Implicated in Huntington's disease; morbid obesity; and obesity. Biomarker of peripheral artery disease and temporal lobe epilepsy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
