-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBCE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 328-527 of human TBCE (NP_003184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against TBCE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 328-527 of human TBCE (NP_003184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-04177A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBCE |
| Target Synonyms | HRD; KCS; KCS1; pac2; PEAMO; TBCE | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 328-527 of human TBCE (NP_003184.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LEKLPSLRALSCLRNPLTKEDKEAETARLLIIASIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPRYQFLCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW | Uniprot ID | Q15813 |
Uniprot Id
Q15813
Target Species
Human
Target Name
TBCE
Target Full Name
Tubulin-specific chaperone E
Target Function
Tubulin-folding protein; involved in the second step of the tubulin folding pathway and in the regulation of tubulin heterodimer dissociation. Required for correct organization of microtubule cytoskeleton and mitotic splindle, and maintenance of the neuronal microtubule network.
Target Involvement
Hypoparathyroidism-retardation-dysmorphism syndrome (HRDS); Kenny-Caffey syndrome 1 (KCS1); Encephalopathy, progressive, with amyotrophy and optic atrophy (PEAMO)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton.
Target Protein Families
TBCE family
Target Synonyms
HRD; KCS; KCS1; Pac2; tbce; TBCE_HUMAN; Tubulin specific chaperone e; Tubulin-folding cofactor E; Tubulin-specific chaperone E
Target Background
Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene.
Notification