Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NTSR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NTSR1 (NP_002522.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NTSR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NTSR1 (NP_002522.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04200A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NTSR1 |
| Target Synonyms | NTR; NTSR1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NTSR1 (NP_002522.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVY | Uniprot ID | P30989 |
Uniprot Id
P30989
Target Species
Human
Target Name
NTSR1
Target Full Name
Neurotensin receptor type 1
Target Function
G-protein coupled receptor for the tridecapeptide neurotensin (NTS). Signaling is effected via G proteins that activate a phosphatidylinositol-calcium second messenger system. Signaling leads to the activation of downstream MAP kinases and protects cells against apoptosis.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft.
Target Protein Families
G-protein coupled receptor 1 family, Neurotensin receptor subfamily, NTSR1 sub-subfamily
Target Tissue Specificity
Expressed in prostate (at protein level). Detected in colon and peripheral blood mononuclear cells. Detected at very low levels in brain.
Target Synonyms
NTSR1; NTRR; Neurotensin receptor type 1; NT-R-1; NTR1; High-affinity levocabastine-insensitive neurotensin receptor; NTRH
Target Background
Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secretion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
