-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRM8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GRM8 (NP_000836.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRM8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GRM8 (NP_000836.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04222A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRM8 |
| Target Synonyms | GLUR8; mGlu8; GPRC1H; MGLUR8; GRM8 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, HepG2, K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GRM8 (NP_000836.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGV | Uniprot ID | O00222 |
Uniprot Id
O00222
Target Species
Human
Target Name
GRM8
Target Full Name
Metabotropic glutamate receptor 8
Target Function
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 3 family
Target Synonyms
FLJ41058; GLUR8; Glutamate receptor metabotropic 8; GPRC1H; GRM8; GRM8_HUMAN; Metabotropic glutamate receptor 8; MGC126724; mGlu8; mGluR8
Target Background
L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification