Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-329 of human CNN3 (NP_001830.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CNN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-329 of human CNN3 (NP_001830.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04311A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNN3 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | 293T, Mouse brain, Mouse lung, Mouse testis, Rat lung |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-329 of human CNN3 (NP_001830.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY | Uniprot ID | Q15417 |
Uniprot Id
Q15417
Target Species
Human
Target Name
CNN3
Target Full Name
Calponin-3
Target Function
Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
Target Protein Families
Calponin family
Target Tissue Specificity
Expressed in both non-smooth muscle tissues as well as smooth muscle tissues.
Target Research Area
Signal Transduction
Target Synonyms
Acidic calponin 3; acidic isoform; Calponin 3 acidic; Calponin 3; Calponin acidic; Calponin acidic isoform; Calponin; Calponin-3; Calponin3; CNN 3; Cnn3; CNN3_HUMAN; dJ639P13.2.2; OTTHUMP00000012470; OTTHUMP00000012471
Target Background
This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
