-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against gamma-Synuclein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human gamma-Synuclein (NP_003078.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against gamma-Synuclein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human gamma-Synuclein (NP_003078.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04337A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | gamma-Synuclein |
| Target Synonyms | SR; BCSG1; gamma-Synuclein | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human gamma-Synuclein (NP_003078.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD | Uniprot ID | O76070 |
Uniprot Id
O76070
Target Species
Human
Target Name
SNCG
Target Full Name
Gamma-synuclein
Target Function
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
Target Subcellular Location
Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle.
Target Protein Families
Synuclein family
Target Tissue Specificity
Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.
Target Synonyms
BCSG1; Breast cancer specific gene 1 protein; Breast cancer specific protein 1; Breast cancer-specific gene 1 protein; Gamma synuclein; Gamma-synuclein; Persyn; PRSN; SNCG; SR; Synoretin; Synuclein gamma; synuclein, gamma (breast cancer-specific protein 1); SYUG_HUMAN
Target Background
This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development.
Notification