-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLR2L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against POLR2L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04347A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLR2L |
| Target Synonyms | RBP10; RPB10; RPABC5; RPB7.6; hRPB7.6; RPB10beta; POLR2L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse ovary | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK | Uniprot ID | P62875 |
Uniprot Id
P62875
Target Species
Human
Target Name
POLR2L
Target Full Name
DNA-directed RNA polymerases I, II, and III subunit RPABC5
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft.
Target Subcellular Location
Nucleus.
Target Protein Families
Archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family
Target Synonyms
and III subunit ABC5; and III subunit RPABC5; DNA directed RNA polymerase II polypeptide L; DNA-directed RNA polymerase III subunit L; DNA-directed RNA polymerases I; hRPB7.6; hsRPB10b; II; POLR2L; RNA polymerase II 7.6 kDa subunit; RNA polymerase II polypeptide L; RNA polymerases I; RPAB5_HUMAN; RPABC5; RPB10; RPB10 homolog; RPB10beta; RPB7.6
Target Background
This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases.
Notification