-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLR2J was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human POLR2J (NP_006225.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against POLR2J was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human POLR2J (NP_006225.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04484A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLR2J |
| Target Synonyms | RPB11; RPB11A; RPB11m; hRPB14; POLR2J1; POLR2J | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human POLR2J (NP_006225.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE | Uniprot ID | P52435 |
Uniprot Id
P52435
Target Species
Human
Target Name
POLR2J
Target Full Name
DNA-directed RNA polymerase II subunit RPB11-a
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.
Target Subcellular Location
Nucleus.
Target Protein Families
Archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family
Target Tissue Specificity
Ubiquitously expressed. High expression was found in heart and skeletal muscle.
Target Synonyms
DNA directed RNA polymerase II subunit RPB11 a; DNA-directed RNA polymerase II 13.3 kDa polypeptide ; DNA-directed RNA polymerase II 13.3 kDa polypeptide; DNA-directed RNA polymerase II subunit J 1; DNA-directed RNA polymerase II subunit J-1; DNA-directed RNA polymerase II subunit RPB11-a; hRPB 14; hRPB14; POLR 2J1; POLR2J; POLR2J1; polymerase (RNA) II (DNA directed) polypeptide J 13.3kDa ; polymerase (RNA) II (DNA directed) polypeptide J 13.3kDa; RNA polymerase II 13.3 kDa subunit; RNA polymerase II subunit B11 a; RNA polymerase II subunit B11-a; RPB 11; RPB 11A; RPB 11m; RPB11; RPB11_HUMAN; RPB11a; RPB11m; Rpo2-4
Target Background
This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13.
Notification