-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABA A Receptor beta 1 (GABRB1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA A Receptor beta 1 (GABRB1) (NP_000803.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABA A Receptor beta 1 (GABRB1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA A Receptor beta 1 (GABRB1) (NP_000803.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04686A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABA A Receptor beta 1 (GABRB1) |
| Target Synonyms | DEE45; EIEE45; GABA A Receptor beta 1 (GABRB1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA A Receptor beta 1 (GABRB1) (NP_000803.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSA | Uniprot ID | P18505 |
Uniprot Id
P18505
Target Species
Human
Target Name
GABRB1
Target Full Name
Gamma-aminobutyric acid receptor subunit beta-1
Target Function
Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand-gated chloride channel.
Target Involvement
Epileptic encephalopathy, early infantile, 45 (EIEE45)
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRB1 sub-subfamily
Target Synonyms
AW061132; B230208N19Rik; GABA(A) receptor beta 1; GABA(A) receptor subunit beta-1; GABA-A receptor; beta-1 polypeptide; Gabrb-1; GABRB1; Gamma aminobutyric acid (GABA) A receptor beta 1; Gamma Aminobutyric Acid A Receptor Beta 1; Gamma Aminobutyric Acid Receptor ; beta-1; Gamma-aminobutyric acid (GABA) A receptor; subunit beta 1; Gamma-aminobutyric acid receptor subunit beta-1; GARB1; GBRB1_HUMAN
Target Background
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia.
Notification