-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNRPN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPN (NP_003088.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SNRPN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPN (NP_003088.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04883A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNRPN |
| Target Synonyms | SMN; PWCR; SM-D; sm-N; RT-LI; HCERN3; SNRNP-N; SNURF-SNRPN; SNRPN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, HT-29, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPN (NP_003088.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA | Uniprot ID | P63162 |
Uniprot Id
P63162
Target Species
Human
Target Name
SNRPN
Target Full Name
Small nuclear ribonucleoprotein-associated protein N
Target Function
May be involved in tissue-specific alternative RNA processing events.
Target Subcellular Location
Nucleus.
Target Protein Families
SnRNP SmB/SmN family
Target Tissue Specificity
Expressed in brain and lymphoblasts.
Target Synonyms
HCERN3; PWCR; RSMN_HUMAN; RT LI; RTLI; SM D; Sm N; Sm protein D; Sm protein N; Sm-D; Sm-N; Small nuclear ribonucleoprotein associated protein N; Small nuclear ribonucleoprotein polypeptide N; Small nuclear ribonucleoprotein-associated protein N; SMD; SmN; SNRNP N; snRNP-N; SNRNPN; SNRPN; SNURF SNRPN; Tissue specific splicing protein; Tissue-specific-splicing protein
Target Background
This gene is located within the Prader-Willi Syndrome critical region on chromosome 15 and is imprinted and expressed from the paternal allele. It encodes a component of the small nuclear ribonucleoprotein complex, which functions in pre-mRNA processing and may contribute to tissue-specific alternative splicing. Alternative promoter use and alternative splicing result in a multitude of transcript variants encoding the same protein. Transcript variants that initiate at the CpG island-associated imprinting center may be bicistronic and also encode the SNRPN upstream reading frame protein (SNURF) from an upstream open reading frame. In addition, long spliced transcripts for small nucleolar RNA host gene 14 (SNHG14) may originate from the promoters at this locus and share exons with this gene. Alterations in this region are associated with parental imprint switch failure, which may cause Angelman syndrome or Prader-Willi syndrome.
Notification