Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RIT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RIT1 (NP_001243749.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RIT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RIT1 (NP_001243749.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04886A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RIT1 |
| Target Synonyms | NS8; RIT; RIBB; ROC1; RIT1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidnay, Rat kdney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RIT1 (NP_001243749.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT | Uniprot ID | Q92963 |
Uniprot Id
Q92963
Target Species
Human
Target Name
RIT1
Target Full Name
GTP-binding protein Rit1
Target Function
Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and MAPK14 signaling pathways and in NGF-dependent neuronal differentiation. Involved in ELK1 transactivation through the Ras-MAPK signaling cascade that mediates a wide variety of cellular functions, including cell proliferation, survival, and differentiation.
Target Involvement
Noonan syndrome 8 (NS8)
Target Subcellular Location
Cell membrane.
Target Protein Families
Small GTPase superfamily, Ras family
Target Tissue Specificity
Expressed in many tissues.
Target Synonyms
GTP binding protein Roc1; GTP-binding protein Rit1; NS8; Ras like protein expressed in many tissues; Ras like without CAAX 1; Ras-like protein expressed in many tissues; Ras-like without CAAX protein 1; RIBB; Ric like expressed in many tissues; Ric-like protein without CAAX motif 1; RIT; RIT1; RIT1_HUMAN; ROC1
Target Background
This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
