Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human GNGT1 (NP_068774.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GNGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human GNGT1 (NP_068774.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04910A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNGT1 |
| Target Synonyms | GNG1; HG3G1; GNGT1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human GNGT1 (NP_068774.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVE | Uniprot ID | P63211 |
Uniprot Id
P63211
Target Species
Human
Target Name
GNGT1
Target Full Name
Guanine nucleotide-binding protein G(T) subunit gamma-T1
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
G protein gamma family
Target Tissue Specificity
Retinal rod outer segment.
Target Synonyms
GNGT1; Guanine nucleotide-binding protein G(T) subunit gamma-T1; Transducin gamma chain
Target Background
This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase by rhodopsin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
