Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB22A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB22A (NP_065724.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB22A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB22A (NP_065724.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05021A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB22A |
| Target Synonyms | RAB22A | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB22A (NP_065724.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWV | Uniprot ID | Q9UL26 |
Uniprot Id
Q9UL26
Target Species
Human
Target Name
RAB22A
Target Full Name
Ras-related protein Rab-22A
Target Function
Plays a role in endocytosis and intracellular protein transport. Mediates trafficking of TF from early endosomes to recycling endosomes. Required for NGF-mediated endocytosis of NTRK1, and subsequent neurite outgrowth. Binds GTP and GDP and has low GTPase activity. Alternates between a GTP-bound active form and a GDP-bound inactive form.
Target Subcellular Location
Endosome membrane; Lipid-anchor. Cell membrane; Lipid-anchor. Early endosome. Late endosome. Cell projection, ruffle. Cytoplasmic vesicle. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, Rab family
Target Synonyms
3732413A17Rik; AI662177; AW319644; AW550514; E130120E14Rik; GTP binding protein RAB22A; MGC16770; OTTMUSP00000017605; Rab 22; RAB 22A; Rab-22; Rab22; RAB22A; RAB22A member RAS oncogene family; Ras related protein Rab 22A; Ras related protein Rab22A; Ras-related protein Rab-22A; RB22A_HUMAN
Target Background
The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
