Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LYRM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human LYRM1 (NP_065157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LYRM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human LYRM1 (NP_065157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05022A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LYRM1 |
| Target Synonyms | A211C6.1; LYRM1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human LYRM1 (NP_065157.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRPIHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDEVS | Uniprot ID | O43325 |
Uniprot Id
O43325
Target Species
Human
Target Name
LYRM1
Target Full Name
LYR motif-containing protein 1
Target Function
May promote cell proliferation and inhibition of apoptosis of preadipocytes.
Target Involvement
When overexpressed, may be involved in obesity-associated insulin resistance, possibly by causing mitochondrial dysfunction in adipocytes.
Target Subcellular Location
Nucleus.
Target Protein Families
Complex I LYR family
Target Tissue Specificity
High levels in adipose tissue.
Target Synonyms
1110065L10Rik; 2310004B22Rik; 4930404J24Rik; A211C6.1; LYR motif containing 1; LYR motif containing protein 1; LYR motif-containing protein 1; LYRM 1; lyrm1; LYRM1_HUMAN; OTTHUMP00000162292; OTTMUSP00000031126; OTTMUSP00000031127; OTTMUSP00000031128; OTTMUSP00000031129; RGD1563498
Target Background
The protein encoded by this gene belongs to the mitochondrial leucine/tyrosine/arginine motif family of proteins. Proteins of this family are short polypeptides that contain a leucine/tyrosine/arginine motif near the N-terminus. This gene is widely expressed with high levels in omental adipose tissue of obese individuals. In adipose tissue, the protein is localized to the nucleus where it promotes preadipocyte proliferation and lowers the rate of apoptosis to regulate adipose tissue homeostasis. Overexpression of this gene in adipocytes causes abnormal mitochondrial morphology and mitochondrial dysfunction. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
