Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC44A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-210 of human SLC44A1 (NP_536856.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC44A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-210 of human SLC44A1 (NP_536856.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05081A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC44A1 |
| Target Synonyms | CD92; CTL1; CDW92; CHTL1; CONATOC; SLC44A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, LO2, Mouse brain, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 55-210 of human SLC44A1 (NP_536856.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AARLVSGYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMT | Uniprot ID | Q8WWI5 |
Uniprot Id
Q8WWI5
Target Species
Human
Target Name
SLC44A1
Target Full Name
Choline transporter-like protein 1
Target Function
Choline transporter. Involved in membrane synthesis and myelin production.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein.
Target Protein Families
CTL (choline transporter-like) family
Target Tissue Specificity
Expressed in various cells of the hematopoietic system.
Target Synonyms
CD 92; CD92; CD92 antigen; CD92 protein; CDW 92; CDw92; CDW92 antigen; Choline transporter like protein 1; Choline transporter-like protein 1; CHTL 1; CHTL1; CTL 1; CTL1; CTL1_HUMAN; RP11 287A8.1; slc44a1; Solute carrier family 44 member 1
Target Background
Enables choline transmembrane transporter activity. Involved in choline transport and transmembrane transport. Located in several cellular components, including cytosol; mitochondrion; and nucleoplasm. Implicated in high grade glioma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
