-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1264-1363 of human PRG4 (NP_001121180.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1264-1363 of human PRG4 (NP_001121180.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05101A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRG4 |
| Target Synonyms | MSF; SZP; CACP; HAPO; JCAP; PRG4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1264-1363 of human PRG4 (NP_001121180.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP | Uniprot ID | Q92954 |
Uniprot Id
Q92954
Target Species
Human
Target Name
PRG4
Target Full Name
Proteoglycan 4
Target Function
Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.; Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.
Target Involvement
Camptodactyly-arthropathy-coxa vara-pericarditis syndrome (CACP)
Target Subcellular Location
Secreted.
Target Tissue Specificity
Highly expressed in synovial tissue, cartilage and liver and weakly in heart and lung. Isoform B is expressed in kidney, lung, liver, heart and brain. Isoform C and isoform D are widely expressed.
Target Research Area
Signal Transduction
Target Synonyms
PRG4; MSF; SZP; Proteoglycan 4; Lubricin; Megakaryocyte-stimulating factor; Superficial zone proteoglycan) [Cleaved into: Proteoglycan 4 C-terminal part]
Target Background
The protein encoded by this gene is a large proteoglycan that is synthesized by chondrocytes located at the surface of articular cartilage and by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Alternative splicing results in multiple transcript variants.
Notification